Dpy19l1 Rabbit Polyclonal Antibody

• Catalog Number: orb578861
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Dpy19l1
• Target: Dpy19l1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: VKLSALRPVVNHPHYEDAGLRARTKIVYSMYSRKAPEDVKKELMKLKVNY
• UniProt ID: A6X919
• MW: 62kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AI225861, AW558481, 6030402K12, 1100001I19Rik
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• NCBI: NP_766508

WB Suggested Anti-Dpy19l1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Brain.