You have no items in your shopping cart.
Cart summary
Item 1 of 1
DOK6 Rabbit Polyclonal Antibody
Catalog Number: orb582784
| Catalog Number | orb582784 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to DOK6 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DOK6 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 38 |
| Target | DOK6 |
| UniProt ID | Q6PKX4 |
| Protein Sequence | Synthetic peptide located within the following region: IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI |
| NCBI | NP_689934 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | DOK5L, HsT3226 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-DOK6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: COLO205 cell lysate.
- Item 1 of 3
Anti-DOK6 Antibody [orb318784]
IF, IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 4
- Item 1 of 2
DOK6 Antibody [orb126879]
IF, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
200 μg, 50 μg, 100 μg, 25 μg - Item 1 of 1
- Item 1 of 1
