Dnajc27 Rabbit Polyclonal Antibody

SKU: orb583372

Description

Rabbit polyclonal antibody to Dnajc27

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Dnajc27
• Protein Sequence: Synthetic peptide located within the following region: DYGVTKVQVRDREIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQK
• Molecular Weight: 30kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Ra, Rb, Rbj, Rabj, AI639580, C330021A05Rik

WB Suggested Anti-Dnajc27 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Kidney.

Quick Database Links

Gene Symbol

Dnajc27

UniProt

Q8CFP6

RefSeq (Protein):NP_694722