DNAJC25-GNG10 Rabbit Polyclonal Antibody

• Catalog Number: orb324986
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GNG10
• Target: DNAJC25-GNG10
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC552891
• Protein Sequence: Synthetic peptide located within the following region: AGALVEGLYCGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQP
• UniProt ID: Q9H1X3
• MW: 16kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Research Area: Disease Biomarkers, Signal Transduction
• Note: For research use only
• NCBI: NP_004116

WB Suggested Anti-DNAJC25-GNG10 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Placenta.