Dnajc21 Rabbit Polyclonal Antibody

• Catalog Number: orb585425
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Dnajc21
• Target: Dnajc21
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: FYAHWQSFCTQKNFSWKEEYDTRQASNRWEKRAMEKENKKIRDRARKEKN
• UniProt ID: E9Q8D0
• MW: 58kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: 4930461P20Rik, 9930116P15Rik
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_084322

WB Suggested Anti-Dnajc21 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Small Intestine.