DMP1 monoclonal antibody (M01), clone 1D4

• Catalog Number: orb2293556
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DMP1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: DMP1 (NP_004398.1, 221 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: ESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEES
• Tested applications: ELISA, IF, WB
• Clone Number: 1D4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004398.1

Detection limit for recombinant GST tagged DMP1 is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to DMP1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (37.84 KDa).