You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293560 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human DLX6 protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | DLX6 (AAH69363.1, 1 a.a. ~ 175 a.a) full-length human protein. |
Protein Sequence | MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH69363.1 |
DLX6 MaxPab rabbit polyclonal antibody. Western Blot analysis of DLX6 expression in human kidney.
Western Blot analysis of DLX6 expression in transfected 293T cell line by DLX6 MaxPab polyclonal antibody. Lane 1: DLX6 transfected lysate (19.70 KDa). Lane 2: Non-transfected lysate.