You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293562 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant DLX5. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | DLX5 (NP_005212, 191 a.a. ~ 279 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH |
Tested applications | ELISA, IF, WB |
Clone Number | 3B11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_005212 |
DLX5 monoclonal antibody (M12), clone 3B11 Western Blot analysis of DLX5 expression in A-431.
DLX5 monoclonal antibody (M12), clone 3B11. Western Blot analysis of DLX5 expression in NIH/3T3.
DLX5 monoclonal antibody (M12), clone 3B11. Western Blot analysis of DLX5 expression in PC-12.
DLX5 monoclonal antibody (M12), clone 3B11. Western Blot analysis of DLX5 expression in Raw 264.7.
Immunofluorescence of monoclonal antibody to DLX5 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of DLX5 expression in transfected 293T cell line by DLX5 monoclonal antibody (M12), clone 3B11. Lane 1: DLX5 transfected lysate (31.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.79 KDa).