DLK1 Rabbit Polyclonal Antibody

• Catalog Number: orb579767
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DLK1
• Target: DLK1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DLK1
• Protein Sequence: Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
• UniProt ID: P80370
• MW: 41kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DLK, FA1, ZOG, pG2, DLK-1, PREF1, Delta1, Pref-1
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_003827

WB Suggested Anti-DLK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Stomach.