You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293625 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant DIAPH1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | DIAPH1 (NP_005210, 921 a.a. ~ 1024 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS |
Tested applications | ELISA, WB |
Clone Number | 5A8 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_005210 |
Detection limit for recombinant GST tagged DIAPH1 is approximately 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.18 KDa).