DHX30 Rabbit Polyclonal Antibody

• Catalog Number: orb575992
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DHX30
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DHX30
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40 kDa
• Target: DHX30
• UniProt ID: Q7L2E3
• Protein Sequence: Synthetic peptide located within the following region: AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD
• NCBI: NP_619519
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DDX30, RETCOR, NEDMIAL
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-DHX30 Antibody, Catalog Number: orb575992, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, moderate signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-DHX30 Antibody, Catalog Number: orb575992, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic in alveolar type I cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-DHX30 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. DHX30 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.