DHODH monoclonal antibody (M01), clone 6E1

• Catalog Number: orb2293637
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DHODH.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Lambda
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: DHODH (NP_001352, 32 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQ
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 6E1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001352

Detection limit for recombinant GST tagged DHODH is approximately 0.3 ng/ml as a capture antibody.

DHODH monoclonal antibody (M01), clone 6E1 Western Blot analysis of DHODH expression in MCF-7.

Immunoperoxidase of monoclonal antibody to DHODH on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (37.73 KDa).