DEFA6 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2293666
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human DEFA6 protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: DEFA6 (NP_001917.1, 1 a.a. ~ 100 a.a) full-length human protein.
• Protein Sequence: MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001917.1

Western Blot analysis of DEFA6 expression in transfected 293T cell line by DEFA6 MaxPab polyclonal antibody. Lane 1: DEFA6 transfected lysate (11.00 KDa). Lane 2: Non-transfected lysate.