DEFA6 monoclonal antibody (M01), clone 2D2

• Catalog Number: orb2293665
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant DEFA6.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D2
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: DEFA6 (NP_001917.1, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
• NCBI: NP_001917.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged DEFA6 is 1 ng/ml as a capture antibody.

Western Blot analysis of DEFA6 expression in transfected 293T cell line by DEFA6 monoclonal antibody (M01), clone 2D2. Lane 1: DEFA6 transfected lysate (Predicted MW: 11 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.4 KDa).