You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291181 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant DEF6. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | DEF6 (AAH17504, 1 a.a. ~ 336 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR |
Tested applications | ELISA, IHC-P, IP, WB |
Clone Number | 1F2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH17504 |
Detection limit for recombinant GST tagged DEF6 is approximately 1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to DEF6 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Immunoprecipitation of DEF6 transfected lysate using anti-DEF6 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DEF6 monoclonal antibody.
Western Blot detection against Immunogen (62.7 KDa).