DEF6 MaxPab mouse polyclonal antibody (B01)

• Catalog Number: orb2291182
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human DEF6 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: DEF6 (NP_071330, 1 a.a. ~ 631 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEEAARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTRLLEEEEEKLKQLMQLKEEQERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGGDEAPAPASTPQEDKLDPAPEN
• NCBI: NP_071330
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Application notes: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
• Expiration Date: 12 months from date of receipt.

DEF6 MaxPab polyclonal antibody. Western Blot analysis of DEF6 expression in human spleen.

Western Blot analysis of DEF6 expression in transfected 293T cell line by DEF6 MaxPab polyclonal antibody. Lane 1: DEF6 transfected lysate(69.41 KDa). Lane 2: Non-transfected lysate.