You have no items in your shopping cart.
Cart summary
Item 1 of 1
DDX60L Rabbit Polyclonal Antibody
Catalog Number: orb586978
| Catalog Number | orb586978 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to DDX60L |
| Target | DDX60L |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Equine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human DDX60L |
| Protein Sequence | Synthetic peptide located within the following region: YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKW |
| UniProt ID | Q5H9U9 |
| MW | 187kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_001012985 |
Sample Type: PANC1 Whole cell lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 2
- Item 1 of 2
DDX60L Rabbit Polyclonal Antibody (Biotin) [orb2088421]
WB
Equine, Human
Rabbit
Polyclonal
Biotin
100 μl
