DDX50 Rabbit Polyclonal Antibody

• Catalog Number: orb575986
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DDX50
• Target: DDX50
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDX50
• Protein Sequence: Synthetic peptide located within the following region: PGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENG
• UniProt ID: Q9BQ39
• MW: 82kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GU2, GUB, mcdrh, RH-II/GuB
• Note: For research use only
• NCBI: NP_076950

WB Suggested Anti-DDX50 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. DDX50 is supported by BioGPS gene expression data to be expressed in HEK293T.