DDIT4L Rabbit Polyclonal Antibody

SKU: orb55693

Description

Rabbit polyclonal antibody to DDT4L.

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDT4L
• Target: DDIT4L
• Protein Sequence: Synthetic peptide located within the following region: ESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEP
• Molecular Weight: 21 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

REDD2, Rtp801L

Sample Tissue: Human 721_B, Antibody dilution: 1.0 ug/ml.

Sample Tissue: RPMI8226 Whole Cell lysates, Antibody dilution: 1 ug/ml.

Sample Type: 293T Whole Cell lysates, Antibody dilution: 0.1 ug/ml.

Quick Database Links

Gene Symbol

DDIT4L

UniProt

Q96D03

RefSeq (Protein):NP_660287