Dcun1d2 Rabbit Polyclonal Antibody

SKU: orb586977

Description

Dcun1d2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Dcun1d2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dcun1d2. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dcun1d2
• Target: Dcun1d2
• Protein Sequence: Synthetic peptide located within the following region: MHKLKSAQKDKVRQFMACTQASERTAIYCLTQNEWKLDEATDSFFQNPEA
• Molecular Weight: 21kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DCNL2, AW495713, mFLJ10704

Quick Database Links

Gene Symbol

Dcun1d2

UniProt

Q8BZJ7

RefSeq (Protein):NP_001036114