You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
XTP3TPA Rabbit Polyclonal Antibody
Catalog Number: orb579754
| Catalog Number | orb579754 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to XTP3TPA |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human XTP3TPA |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 19kDa |
| Target | DCTPP1 |
| UniProt ID | Q9H773 |
| Protein Sequence | Synthetic peptide located within the following region: KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST |
| NCBI | NP_077001 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | CDA03, RS21C6, XTP3TPA Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Human kidney
WB Suggested Anti-XTP3TPA Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. DCTPP1 is supported by BioGPS gene expression data to be expressed in HepG2.
- Item 1 of 2
- Item 1 of 2
XTP3TPA Antibody (N-term) [orb1931426]
IHC-P, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 1
- Item 1 of 1
XTP3TPA Rabbit Polyclonal Antibody (HRP) [orb2116919]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Human
Rabbit
Polyclonal
HRP
100 μl
