DBI Rabbit Polyclonal Antibody

SKU: orb574529

Description

Rabbit polyclonal antibody to DBI

Research Area

Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DBI
• Target: DBI
• Protein Sequence: Synthetic peptide located within the following region: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF
• Molecular Weight: 10kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

EP, ACBP, ACBD1, CCK-RP

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml.

Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5 ug/ml using anti-DBI antibody (orb574529).

WB Suggested Anti-DBI Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

DBI

UniProt

P07108

RefSeq (Protein):NP_001073331