Cytokeratin 19/KRT19 Antibody

• Catalog Number: orb316578
• Category: Antibodies
• Description: Cytokeratin 19/KRT19 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Immunofluorescence, 5μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 44106 MW
• UniProt ID: P08727
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Keratin, type I cytoskeletal 19;Cytokeratin-19;CK-
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of MCF-7 cells using anti-Cytokeratin 19 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis using anti-Cytokeratin 19 antibody.Lane 1:human placenta tissue.2:human MCF-7 cell; 3:human SW620 cell; 4:human HepG2 cell; 5:human PANC-1 cell; 6:rat lung tissue; 7:rat small intestine tissue; 8:mouse lung tissue; 9:mouse HEPA1-6 cell.

IF analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody. Cytokeratin 19 was detected in immunocytochemical section of MCF-7 cells.

IF analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody. Cytokeratin 19 was detected in a paraffin-embedded section of human colon cancer tissue.

IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of human lung cancer tissues.

IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of human intestinal cancer tissues.

IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of human lung cancer tissues.

IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of rat small intestine tissues.

IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of mouse small intestine tissues.

IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of human lung cancer tissues.