Cytokeratin 19 KRT19 Antibody (monoclonal, 3D4)

• Catalog Number: orb421122
• Category: Antibodies
• Description: Cytokeratin 19 KRT19 Antibody (monoclonal, 3D4)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D4
• Tested applications: IF, IHC, WB
• Reactivity: Human
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunofluorescence, 2μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 44 kDa
• UniProt ID: P08727
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Keratin, type I cytoskeletal 19; Cytokeratin-19; C
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human SK-OV-3 cell;4:human COLO-320 cell.

IF analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody.Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissues.

IHC analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody.Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissue.