You have no items in your shopping cart.
Cart summary
Item 1 of 1
CYP2W1 Rabbit Polyclonal Antibody
Catalog Number: orb584796
| Catalog Number | orb584796 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CYP2W1 |
| Target | CYP2W1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2W1 |
| Protein Sequence | Synthetic peptide located within the following region: PVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTETTSATLQWAA |
| UniProt ID | Q8TAV3 |
| MW | 54kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MGC34287 |
| Note | For research use only |
| NCBI | NP_060251 |
WB Suggested Anti-CYP2W1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Lung.
- Item 1 of 4
CYP2W1 rabbit pAb [orb764982]
ELISA, IF, IHC-P, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 2
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
