You have no items in your shopping cart.
Cart summary
CYP2A7 Peptide - N-terminal region
Catalog Number: orb2011060
| Catalog Number | orb2011060 |
|---|---|
| Category | Proteins |
| Description | CYP2A7 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN |
| UniProt ID | P20853 |
| MW | 56kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with CYP2A7 Rabbit Polyclonal Antibody (orb578217). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CPA7, CPAD, CYP2A, CYPIIA7, P450-IIA4 |
| Note | For research use only |
| NCBI | NP_000755 |
