CYP2A13 Rabbit Polyclonal Antibody

• Catalog Number: orb578221
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CYP2A13
• Target: CYP2A13
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2A13
• Protein Sequence: Synthetic peptide located within the following region: DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
• UniProt ID: Q16696
• MW: 54kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CPAD, CYP2A, CYPIIA13
• Research Area: Cell Biology, Disease Biomarkers, Signal Transduct
• Note: For research use only
• NCBI: NP_000757

WB Suggested Anti-CYP2A13 Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate.