You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2815856 |
---|---|
Category | Proteins |
Description | CYLD Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli with N-10xHis, C-Myc. The accession number is Q80TQ2. |
Tag | N-10xHis, C-Myc |
Protein Sequence | GLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVLLRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK |
UniProt ID | Q80TQ2 |
MW | 50.6 kDa (Predicted) |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expression System | E. coli |
Biological Origin | Mouse |
Expression Region | 579-952 aa |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |