Cyclin T1/CCNT1 Antibody

• Catalog Number: orb371724
• Category: Antibodies
• Description: Cyclin T1/CCNT1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, IHC-Fr, WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related mouse sequence by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 80685 MW
• UniProt ID: O60563
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Cyclin-T1;CycT1;Cyclin-T;CCNT1;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U20S cells using anti-Cyclin T1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of U937 cells using anti-Cyclin T1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of Cyclin T1 using anti-Cyclin T1 antibody.Lane 1:rat kidney tissue; 2:mouse spleen tissue;3:JURKAT cell.

IF analysis of Cyclin T1 using anti-Cyclin T1 antibody.Cyclin T1 was detected in immunocytochemical section of A431 cells.

IHC analysis of Cyclin T1 using anti-Cyclin T1 antibody. Cyclin T1 was detected in a paraffin-embedded section of mouse intestine tissue.

IHC analysis of Cyclin T1 using anti-Cyclin T1 antibody. Cyclin T1 was detected in a paraffin-embedded section of rat intestine tissue.

IHC analysis of Cyclin T1 using anti-Cyclin T1 antibody. Cyclin T1 was detected in a paraffin-embedded section of human intestinal cancer tissue.