You have no items in your shopping cart.
Cart summary
CYBB Recombinant Protein (Human)
Catalog Number: orb2054216
| Catalog Number | orb2054216 |
|---|---|
| Category | Proteins |
| Description | CYBB Recombinant Protein (Human) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 37.2 kDa |
| UniProt ID | P04839 |
| Protein Sequence | ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
| Source | E.coli |
| NCBI | NP_000388 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | AMCBX2;CGD;CGD91-phox;CGDX;cytochrome b(558) subun Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human CYBB protein [orb54053]
Greater than 90% as determined by SDS-PAGE.
37.2 kDa
E.coli
20 μg, 100 μg, 1 mgHuman CYBB protein [orb418718]
Greater than 90% as determined by SDS-PAGE.
49.2 kDa
E.coli
20 μg, 100 μg, 1 mgCYBB Recombinant Protein (Human) [orb2054214]
Greater than 90% as determined by SDS-PAGE.
37.2 kDa
E.coli
20 μgCYBB Recombinant Protein (Human) [orb2054215]
Greater than 90% as determined by SDS-PAGE.
37.2 kDa
E.coli
1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
