You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2054214 |
---|---|
Category | Proteins |
Description | CYBB Recombinant Protein (Human) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 37.2 kDa |
UniProt ID | P04839 |
Protein Sequence | ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Source | E.coli |
NCBI | NP_000388 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | AMCBX2;CGD;CGD91-phox;CGDX;cytochrome b(558) subun Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
37.2 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
49.2 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
37.2 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
37.2 kDa | |
E.coli |
Filter by Rating