You have no items in your shopping cart.
Cart summary
Item 1 of 1
CXCR6 Rabbit Polyclonal Antibody
Catalog Number: orb592725
| Catalog Number | orb592725 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CXCR6 |
| Target | CXCR6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CXCR6 |
| Protein Sequence | Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL |
| UniProt ID | O00574 |
| MW | 39kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | BONZO, CD186, CDw186, STRL33, TYMSTR |
| Note | For research use only |
| NCBI | NP_006555 |
WB Suggested Anti-CXCR6 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.
- Item 1 of 5
- Item 1 of 4
- Item 1 of 1
