You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291940 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CXCR4. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS |
Tested applications | ELISA, WB |
Clone Number | 2G9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH20968 |
CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in human colon.
CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in human intestinal wall.
CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in RIN-m5F.
Detection limit for recombinant GST tagged CXCR4 is 0.03 ng/ml as a capture antibody.
Western Blot analysis of CXCR4 expression in transfected 293T cell line by CXCR4 monoclonal antibody (M04), clone 2G9. Lane 1: CXCR4 transfected lysate (Predicted MW: 39.7 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (30.8 KDa).