You have no items in your shopping cart.
Cart summary
CXCL7 Protein, Human, Recombinant (Active)
Catalog Number: orb2816150
| Catalog Number | orb2816150 |
|---|---|
| Category | Proteins |
| Description | CXCL7 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P02775. |
| Tag | Tag Free |
| Protein Sequence | AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
| UniProt ID | P02775 |
| MW | 7.6 kDa (Predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 59-128 aa |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human CXCL7 protein (Active) [orb359054]
> 97% as determined by SDS-PAGE and HPLC.
7.6 kDa
E.Coli
10 μg, 100 μg, 500 μg
