CXCL14 Rabbit Polyclonal Antibody

• Catalog Number: orb592722
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CXCL14
• Target: CXCL14
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CXCL14
• Protein Sequence: Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE
• UniProt ID: O95715
• MW: 9kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: KEC, KS1, BMAC, BRAK, NJAC, MIP2G, MIP-2g, SCYB14
• Research Area: Cell Biology, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_004878
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Spleen tissue at an antibody concentration of 5 ug/ml using anti-CXCL14 antibody (orb592722).

WB Suggested Anti-CXCL14 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate.