Cart summary

You have no items in your shopping cart.

CWF19L1 Rabbit Polyclonal Antibody (FITC)

CWF19L1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2086686

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2086686
CategoryAntibodies
DescriptionCWF19L1 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human CWF19L1
Protein SequenceSynthetic peptide located within the following region: FPLQFGREVLASEAILNVPDKSDWRQCQISKEDEETLARRFRKDFEPYDF
UniProt IDQ69YN2
MW26kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesC19L1, hDrn1, SCAR17
NoteFor research use only
  • CWF19L1 Rabbit Polyclonal Antibody (FITC) [orb2086683]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl