You have no items in your shopping cart.
Cart summary
CUX1 Peptide - middle region
Catalog Number: orb1997957
Product Properties
| Catalog Number | orb1997957 |
|---|---|
| Category | Proteins |
| Description | CUX1 Peptide - middle region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: DPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQPCEPPSVGIDYSQGASPQP |
| UniProt ID | P53564 |
| MW | 50 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CDP, Cux, Cutl1, Cux-1 |
| Note | For research use only |
| NCBI | NP_001278162.1 |
| Expiration Date | 6 months from date of receipt. |
Images
Similar Products
Reviews
CUX1 Peptide - middle region (orb1997957)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review