CUL5 Rabbit Polyclonal Antibody

SKU: orb575379

Description

Rabbit polyclonal antibody to CUL5

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CUL5
• Target: CUL5
• Protein Sequence: Synthetic peptide located within the following region: VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH
• Molecular Weight: 86kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CUL-5, VACM1, VACM-1

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

WB Suggested Anti-CUL5 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

CUL5

UniProt

Q93034

RefSeq (Protein):NP_003469