CUL3 Rabbit Polyclonal Antibody

SKU: orb584955

Description

Rabbit polyclonal antibody to CUL3

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CUL3
• Target: CUL3
• Protein Sequence: Synthetic peptide located within the following region: QETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTS
• Molecular Weight: 84kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CUL-3, PHA2E, NEDAUS

Immunohistochemistry with Testis tissue at an antibody concentration of 10 ug/ml using anti-CUL3 antibody (orb584955).

WB Suggested Anti-CUL3 Antibody Titration: 1 ug/ml, Positive Control: Fetal liver cell lysate.

Quick Database Links

Gene Symbol

CUL3

UniProt

Q13618

RefSeq (Protein):NP_003581