You have no items in your shopping cart.
Ctsz Rabbit Polyclonal Antibody
SKU: orb579386
Description
Research Area
Protein Biochemistry
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | Ctsz |
| Protein Sequence | Synthetic peptide located within the following region: SAARARLYFRSGQTCYHPIRGDQLALLGRRTYPRPHEYLSPADLPKNWDW |
| Molecular Weight | 34kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CTS, CTSX, AI787083, AU019819, D2Wsu143, D2Wsu143e
Similar Products
−Cleaved-Cathepsin Z (L62) rabbit pAb Antibody [orb763908]
ELISA, WB
Human, Monkey
Polyclonal
Unconjugated
100 μl, 50 μlCathepsin Z Rabbit Polyclonal Antibody [orb783041]
WB
Bovine, Canine, Equine, Human, Rabbit, Sheep
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-Ctsz Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.
Documents Download
Datasheet
Product Information
Request a Document
Ctsz Rabbit Polyclonal Antibody (orb579386)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




