You have no items in your shopping cart.
CTSC Rabbit Polyclonal Antibody
SKU: orb331087
Description
Research Area
Cell Biology, Immunology & Inflammation
Images & Validation
−Item 1 of 2
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTSC |
| Target | CTSC |
| Protein Sequence | Synthetic peptide located within the following region: VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGD |
| Molecular Weight | 50kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−JP, HMS, JPD, PLS, CPPI, DPP1, DPPI, PALS, DPP-I, PDON1
Similar Products
−- Item 1 of 1
- Item 1 of 1
- Item 1 of 2
Cleaved-Cathepsin C HC (R394) rabbit pAb Antibody [orb763900]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 2
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Sample Type: HCT15 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-CTSC Antibody, Catalog Number: orb331087, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in lysosomes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Quick Database Links
Gene Symbol
CTSC
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
CTSC Rabbit Polyclonal Antibody (orb331087)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1 - 2 weeks