Cart summary

You have no items in your shopping cart.

CTSA Peptide - N-terminal region

CTSA Peptide - N-terminal region

Catalog Number: orb1999976

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1999976
CategoryProteins
DescriptionCTSA Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW54 kDa
UniProt IDP10619
Protein SequenceSynthetic peptide located within the following region: DQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVL
NCBINP_000299.2
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesGSL, GLB2, NGBE, PPCA, PPGB
Read more...
NoteFor research use only
Application notesThis is a synthetic peptide designed for use in combination with CTSA Rabbit Polyclonal Antibody (orb589643). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Expiration Date6 months from date of receipt.