You have no items in your shopping cart.
Cart summary
CTGF/CCN2 Protein, Human, Recombinant (His)
Catalog Number: orb1978845
| Catalog Number | orb1978845 |
|---|---|
| Category | Proteins |
| Description | Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. CTGF/CCN2 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.1 kDa and the accession number is P29279. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 15.1 kDa (predicted) |
| UniProt ID | P29279 |
| Protein Sequence | GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. CTGF/CCN2 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.1 kDa and the accession number is P29279. |
| Expression Region | 253-349 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Recombinant human CTGF / CCN2 protein, C-His-Avi (HEK293) [orb1516473]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 40-50 kDa based on Tris-Bis PAGE result.
100 μg CTGF/CCN2 Protein, Human, Recombinant (HEK293, His) [orb1961166]
96.00%
33-45 KDa (reducing condition)
1 mg, 500 μg, 50 μg, 10 μgCTGF/CCN2 Protein, Human, Recombinant (His & Avi), Biotinylated [orb1959919]
> 95% as determined by Bis-Tris PAGE
38.4 kDa (predicted). Due to glycosylation, the protein migrates to 43-53 kDa based on Tris-Bis PAGE result.
1 mg, 500 μg, 100 μgRecombinant Human CTGF / CCN2 Protein, Avi His Tag [orb1550552]
> 95% by Tris-Bis PAGE, > 95% by SEC-HPLC
Recombinant Human CTGF / CCN2 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Gln27-Ala349) of Human CTGF / CCN2 fused with a His Tag at the C-terminal.
100 μg
