CTCF Rabbit Polyclonal Antibody

• Catalog Number: orb592866
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CTCF
• Target: CTCF
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTCF
• Protein Sequence: Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE
• UniProt ID: P49711
• MW: 83kDa
• Tested applications: ChIP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MRD21, FAP108, CFAP108
• Note: For research use only
• NCBI: NP_006556

Chromatin Immunoprecipitation (ChIP) Using CTCF antibody - N-terminal region (orb592866) and HCT116 Cells.

WB Suggested Anti-CTCF Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.