CTAG1B Rabbit Polyclonal Antibody

• Catalog Number: orb331108
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CTAG1B
• Target: CTAG1B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CTAG1B
• Protein Sequence: Synthetic peptide located within the following region: NILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
• UniProt ID: P78358
• MW: 18kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CT6.1 antibody, anti CTAG antibody, anti CTAG
• Research Area: Protein Biochemistry, Signal Transduction
• Note: For research use only
• NCBI: NP_001318

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-CTAG1B Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.