You have no items in your shopping cart.
Cart summary
CT83 Protein-VLP, Human, Recombinant (His)
Catalog Number: orb1978321
| Catalog Number | orb1978321 |
|---|---|
| Category | Proteins |
| Description | CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293. |
| Tag | N-6xHis(This tag can be tested only under denaturing conditions) |
| Purity | 98.00% |
| Protein Sequence | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| UniProt ID | Q5H943 |
| MW | 14.0 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | HEK293 Cells |
| Biological Origin | Human |
| Biological Activity | CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293. |
| Expression Region | 1-113 aa |
| Storage | -20°C |
| Note | For research use only |
