CSTB purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2293997
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CSTB protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CSTB (NP_000091.1, 1 a.a. ~ 98 a.a) full-length human protein.
• Protein Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000091.1

CSTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CSTB expression in A-431.

CSTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CSTB expression in human placenta.

Western Blot analysis of CSTB expression in transfected 293T cell line by CSTB MaxPab polyclonal antibody. Lane 1: CSTB transfected lysate (11.10 KDa). Lane 2: Non-transfected lysate.