CSNK1D Rabbit Polyclonal Antibody

• Catalog Number: orb327441
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KC1D
• Target: CSNK1D
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KC1D
• Protein Sequence: Synthetic peptide located within the following region: FDWNMLKFGASRAADDAERERRDREERLRHSRNPATRGLPSTASGRLRGT
• UniProt ID: P48730
• MW: 45kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CSNK1D antibody, anti HCKID antibody, anti an
• Note: For research use only

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.