You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1978827 |
---|---|
Category | Proteins |
Description | Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization. CSH2 Protein, Human, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 53.8 kDa and the accession number is P0DML3. |
Tag | N-6xHis-GST |
Protein Sequence | VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF |
UniProt ID | P0DML3 |
MW | 53.8 kDa (predicted) |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expression System | E. coli |
Biological Origin | Human |
Expression Region | 27-217 aa |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |