You have no items in your shopping cart.
Cart summary
CSH2 Protein, Human, Recombinant (GST & His)
Catalog Number: orb1978827
| Catalog Number | orb1978827 |
|---|---|
| Category | Proteins |
| Description | Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization. CSH2 Protein, Human, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 53.8 kDa and the accession number is P0DML3. |
| Tag | N-6xHis-GST |
| Purity | 98.00% |
| Protein Sequence | VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF |
| UniProt ID | P0DML3 |
| MW | 53.8 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization. CSH2 Protein, Human, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 53.8 kDa and the accession number is P0DML3. |
| Expression Region | 27-217 aa |
| Storage | -20°C |
| Note | For research use only |
