CRYZ MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2294091
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CRYZ protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: No additive
• Immunogen: CRYZ (NP_001880.2, 1 a.a. ~ 329 a.a) full-length human protein.
• Protein Sequence: MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL
• Tested applications: IP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001880.2

Immunoprecipitation of CRYZ transfected lysate using anti-CRYZ MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRYZ purified MaxPab mouse polyclonal antibody (B01P) (orb2294092).

Western Blot analysis of CRYZ expression in transfected 293T cell line by CRYZ MaxPab polyclonal antibody. Lane 1: CRYZ transfected lysate(35.20 KDa). Lane 2: Non-transfected lysate.